PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold09526-snap-gene-0.7-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family SRS
Protein Properties Length: 103aa    MW: 11100.4 Da    PI: 9.1615
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold09526-snap-gene-0.7-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70269.41.2e-211163102154
                                    DUF702 102 tsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                                               ++s P +v+++avfrc rv++++dg +e+ Yq++vsi+Ghvf+G+LydqG +e
  maker-scaffold09526-snap-gene-0.7-mRNA-1  11 KKSSPGQVRAPAVFRCHRVTTISDGAAEFVYQATVSISGHVFRGYLYDQGFDE 63 
                                               3558**********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.7E-191062IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016242.7E-241560IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MRDEITDASF KKSSPGQVRA PAVFRCHRVT TISDGAAEFV YQATVSISGH VFRGYLYDQG  60
FDEKNAFPSI SQLHLVSSGS GRKRDASSSP IVAPSNTHLA PVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067729.11e-36PREDICTED: LOW QUALITY PROTEIN: protein LATERAL ROOT PRIMORDIUM 1
SwissprotQ94CK97e-27LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0A0KWX63e-32A0A0A0KWX6_CUCSA; Uncharacterized protein
STRINGVIT_13s0067g02860.t013e-31(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57043154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.24e-28Lateral root primordium (LRP) protein-related